Valg af saltvandsakvariefiltreringssystem

At vælge et filtreringssystem til din tank kan virke som en skræmmende opgave. Der er så mange forskellige typer filtre (Våd / tør, Berlin-metoden, Jaulbert-metoden, beholder, UGF, væske, proteinskimmer osv.) At vælge imellem, det kan være en god ide. Heldigvis er der en temmelig enkel metode til at vælge det rigtige filtersystem til din tank.

Grundlæggende om filter

Inden du kan beslutte, hvilke filtertyper du vil bruge, skal du forstå, hvilken funktion hvert filter udfører. Bortset fra det biologiske filter er intet andet enkelt filter et absolut krav. Lad os se hurtigt på de forskellige filtre.

  • Biologiske filtre
  • Dåse filtre
  • Protein Skimmers
  • Under grusfiltre

Nu hvor du forstår det grundlæggende for hver filtertype, lad os begynde at sammensætte dit filtreringssystem. Den følgende proces vil fjerne muligheder, der ikke fungerer for din situation, en efter en, indtil dine muligheder er reduceret til kun et par typer. Klik på linket herunder for at komme i gang.

Sump eller ingen sump?

Lær, hvad en sump er, fordele og ulemper ved at bruge en sump og de forskellige stilarter af sumps. Der er også information til dem af jer Gør-det-selv, der kan lide at fremstille deres eget udstyr, når det er muligt.

Fordele

  • Tilbyder en platform til det bredeste udbud af udstyr

  • Øger systemets vandmængde



  • Kan fungere som refugium for alger, levende klipper eller mangrover

  • Kan holde alt udstyr synligt

Ulemper

  • Kan være vanskeligt at lodde

  • Kan være støjende

  • Øget chance for eksterne lækager

Nu kommer vi til den første gaffel i vejen med at vælge et filter. Du vælger enten et filter med en sump eller et uden sump.

In-Sump udstyr

Saltvandakvarier, der inkluderer en sump, kan rumme den bredeste række udstyr. Der findes modeller til alt fra pumper, til våde / tørre filtre, til proteinskummere, til varmeovne, til alger, levende klipper og denitratorer, der er designet specielt til sumps.

Hvis du har en grundlæggende idé om, hvilke typer filtre du bruger i din sump, kan du få en fornemmelse af, hvor meget hvert filter koster, og hvilke modeller der fungerer for dig ved at læse anmeldelser læse anmeldelser og sammenligne priser på in-sump protein skimmere, et selvopbygget våd / tørt filter, nedsænkningsvarmere og nedsænkbare pumper (krafthoveder). Mange akvarister inkluderer også levende klipper, nogle af de gavnlige makroalger eller endda mangroveplanter i deres sumps.

Det er ikke vanskeligt at indstille proteinskimmeren i din sump - det tager bare en lille planlægning.

Ekstern placering?

Nogle udstyr (pumper, skimmere, beholderfiltre, UV-filtre) kan placeres uden for tanken og forbindes til tanken med forskellige slanger, rør eller overløb.

Fordele

  • Flere udstyrsmuligheder

  • Ingen grund til at bruge Hang On eller In Tank udstyr

  • Renere tank

Ulemper

  • Kan gøre området nær tanken rodet

  • Øger muligheden for eksterne vandlækager

Den næste gaffel i vejen: Er eksternt placeret udstyr en mulighed eller ønskelig for din situation?

Fjernmonteret udstyr

Hvis du ikke vil have en sump, og du vil holde din tank (indvendigt og udvendigt) så uklart som muligt, kan fjernmonteret udstyr muligvis være billetten for dig. Der er et antal udstyr, der kan monteres i afstand fra din tank. Mange af elementerne nedenfor er specifikt designet til eller kan tilpasses til fjernmontering.

Mange In-Sump Protein Skimmers kan let tilpasses.
De fleste kanisterfiltre er designet til let at tilpasse dem til fjernmontering.
Mange af de kombinerede våde / tørre systemer kan også tilpasses.

Vær forsigtig, når du vælger og opsætter komponenterne. Nogle af dem kræver, at de holdes på samme niveau som tanken.

Hang-On eller In-Tank?

Der er en lang række udstyr, der kan hænges uden for ryggen og siderne af et akvarium. Proteinskummere, vandpumper, våde / tørre filtre og udstyr, der leveres med overløb, kan findes i forskellige stilarter lavet af en række producenter.

De typer udstyr, der kan monteres eller bruges inde i tanken, er noget begrænset. Der er dog et antal filtreringssystemer, der er designet til kun at bruge In-Tank udstyr og materialer. Mange SW akvarium purister bruger meget få enheder og har nogle af de mest fantastiske akvarier, du nogensinde vil se.

Her er den næste gaffel i vejen: Hang-On-Tank udstyr vs In-Tank udstyr.

Hang-On-Tank udstyr

Mange akvarister foretrækker bekvemmeligheden ved Hang-On-Tank-udstyr. Hvis du har rummet (normalt mindre end 8 ') på bagsiden eller siderne af dit akvarium, vil du finde dette et fantastisk sted at hænge alle dine nye tanklegetøj. Næsten enhver type saltvandakvariumudstyr findes i en Hang-On-Tank-stil. Følgende links giver dig en idé om, hvad Hang-On-Tank-udstyr er tilgængeligt på markedet, og hvor meget priserne varierer.

  • Protein skimmers
  • Våde / tørre filtre
  • Dåse filtre
  • refugiums
  • Pumper

Du kan nemt blande og matche forskellige stykker for at afslutte dit filtreringssystemdesign.

Udstyr til tank

At udelukkende stole på In-Tank-udstyr begrænser dine muligheder for filtreringsudstyr noget. Når det er sagt, bruger nogle af de mest fremragende FO-, FOWLR- og Reef-systemer kun det, der kan placeres i tanken til filtrering.

denære GRavel Filters er den gamle standby og fungerer ganske godt. De kræver en smule mere vedligeholdelse end nogle af de andre biologiske filtre, men de er billige (du kan nemt tilpasse din egen UGF) og er let at installere. Kontroversen om undergravelfilter raser sandsynligvis i årevis, men du kan læse argumenterne og tage din egen beslutning om, hvorvidt det vil fungere for dig eller ej.

Live Rock / Berlin-systemerne og Live Sand Filtration & Jaubert eller Plenum System-opsætningerne har eksisteret i et stykke tid og er blandt de favoritter, der bruges af reef-system purister.

Der er et antal In-Tank-Skimmers, der optager lidt plads i din tank og fungerer ganske godt.

Med hensyn til vandcirkulation i din tank giver det store udvalg af dykkbare pumper på markedet i dag dig masser af valg at vælge imellem.

Tilføj en nedsænkningsvarmer (valgfrit) og en luftpumpe (hvis nødvendigt), så er du klar til at gå.